| HOWTO Cancelling keyevents in ComboBox (8 replies) |
| microsoft.public.dotnet.framework.sdk |
| Hello, I'm getting crazy of this. In VB it used to be simple KeyAscii 0... In .NET I haven't find a way to do it. I virtually tried everything but with no success. Any ideas on how to solve. Or better, I just want an AutoComplete combobox style. Thanks Stefan de Vogelaere |
|
| Problem with TCP streams (4 replies) |
| microsoft.public.dotnet.framework.sdk |
| I'm trying to create a page that reads a text file from another web site. I'm re using example code that works when getting whois information, but when it fails to read any information from port 80. But when getting data from port 80, it just sits there waiting for any reply. Thanks in advance. Roger Clark Basically the code read as follows: // start of snippit using System.Net.Sockets; using Syst... |
|
| Reading in Big Endian format from a Stream (3 replies) |
| microsoft.public.dotnet.framework.sdk |
| Hello all, I am reading a Palm Database File (PDB) and it's format is in Big Endian. Anyone know how to properly read off the stream in Big Endian format. I tried using the BinaryReader and passing the second Parameter as System.Text.Encoding.BigEndianUnicode, but this didn't seem to work, using ReadInt16() method I was getting the same results with or without the encoding. Anyone have another ide... |
|
| splash screen (3 replies) |
| microsoft.public.dotnet.framework.sdk |
| hi all i'm attempting to create a splash screen for a forms app in c#. does anyone know of some example code to do this? right now i create a thread that is solely responsible for displaying the splash screen, waiting a few seconds, and then hiding it. this works well, but the images i put on this form do not load. any ideas? thanks in advance noah |
|
| Help w GraphicsPath & Region (3 replies) |
| microsoft.public.dotnet.framework.sdk |
| Does anyone know how to convert a Region to a GraphicsPath object? I'm using a Region to do some polygon clipping (Region.Intersect). I'd like to compute the area of an intersection between two polygonal shapes. I'm not sure how to do this with a Region object. The GraphicsPath object appears to have the functionality I'm looking for, but I don't know how to construct a GraphicsPath with a Region.... |
|
| ADSI in .NET (2 replies) |
| microsoft.public.dotnet.framework.sdk |
| I had some code that worked fine in .net beta2 that pulled user properties from ad in a web service and a web application. Here's part of the code: Dim ntname As String Dim ntacct As String Dim uname As String Dim pos as integer Dim fullname as string ntname User.Identity.Name pos ntname.LastIndexOf("\") 1 uname ntname.Substring(pos) Dim myDir As New DirectoryServices.DirectorySearcher("(& (object... |
|
| Serialization (2 replies) |
| microsoft.public.dotnet.framework.sdk |
| Hi, What is the mechanism that determines when a component is serialized or deserialized? What criteria determines when ISerializable.GetObjectData(...) is called? TIA Larry |
|
| Program cannot run on new version FrameSDK ! Why? (2 replies) |
| microsoft.public.dotnet.framework.sdk |
| Hi,all: It's strange.My program on 2914 version FrameSDK cannot run on 3705 version FrameSDK! The error message is : Configuration Error Description: An error occurred during the processing of a configuration file required to service this request. Please review the specific error details below and modify your configuration file appropriately. Parser Error Message: File or assembly name System.Web,... |
|
| Great product, yes... Ready for prime time, I'll think twice... (6 replies) |
| microsoft.public.dotnet.framework.sdk |
| I love the idea of web server controls that "know" how to render for any given browser, and have spent quite a bit of time developing my own. Being the thorough type, I learned MSIL so I could look at the ILDASM output and get an idea of the design patterns that were used for the intrinsic server controls. The following will show that even in RTM, there exists an infinite loop in the System.Web.SR... |
|
| Server Application Unavailable (2 replies) |
| microsoft.public.dotnet.framework.sdk |
| Hi all ... I just installed the .NET framework; trying to run the samples all I get is "Server Application Unavailable" ... ?? looks like a permissions issue of some sort but I'm lost and can't find a thing in the docs ... such as they are ... Anyone got any ideas ?? Thanks ! JFF |
|
| upgrading from beta2 to final? (2 replies) |
| microsoft.public.dotnet.framework.sdk |
| Hi all, Been running beta2 for a while now and have some asp.net applications running already. Just wanted to know an upgrade path to final version without breaking my applications. Any docs out there on how to do this? Also, is asp.net premium still available? i noticed they removed the link to the download. thanks |
|
| It still doesn't work => a critical issue about releasing memory by Image.Dispose() ! (3 replies) |
| microsoft.public.dotnet.framework.sdk |
| It doesn't work. It may be there is a problem in Dispose(). I guess no implementation at all. Who has any idea? Linus "Dinh Duy" dinhduy.tran@computer.org wrote in message news:uhNGlH3oBHA.2184@tkmsftngp02... If you want to replease all the resource used by image must call Dispose() on image object. (ms help://MS.VSCC/MS.MSDNVS/cpref/html/frlrfsystemdrawingimageclassdisposet opic1.htm) Replace: Pi... |
|
| Getting Current User/Domain (2 replies) |
| microsoft.public.dotnet.framework.sdk |
| Has anyone run into trouble with System.Security.Principal.WindowsIdentity? I am just trying from on a Windows Forms VB.Net project to determine the current user ID and Domain of the user that ran the program, and on Win2k the following works great: '*********** Dim MyID as WindowsIdentity WindowsIdentity.GetCurrent() Label1.Text MyID.Name '*********** However, when I tried to run it on Windows 98... |
|
